PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G188300.2
Common NameB456_004G188300, LOC105791964
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 554aa    MW: 61995.9 Da    PI: 6.7001
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G188300.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.82.1e-27318371256
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          +++Wt+eLH++Fv+av+qL G+++A+P++ilelmkv+gLt+++v+SHLQkYR++
  Gorai.004G188300.2 318 LKVDWTTELHKKFVQAVDQL-GIDQAIPSRILELMKVEGLTRHNVASHLQKYRMH 371
                         5899****************.********************************96 PP

2Response_reg22.45.9e-09201261109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTT.SEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempg.mdGlellkeireeepklpiivvtahgeeedale 88 
                         vl+ d++ + +  +++ le  +y +v ++ +  eal  +  +   +++ ++ +       G+++l++ +    +lp i+ +     +++ +
  Gorai.004G188300.2  20 VLLLDEDTNSAAEIKSKLEAMDY-IVYTFCNENEALSAVSSRPesFHVAIVEVCTNSnNGGFKFLETAK----DLPTIMTSNIHCISTMMK 105
                         79999999999************.***************666666*******88777477888887654....578888887777****** PP

                         HHHTTESEEEESS--HHHHHH CS
        Response_reg  89 alkaGakdflsKpfdpeelvk 109
                         ++ +Ga +fl Kp ++++l++
  Gorai.004G188300.2 106 CIALGAVEFLRKPLSEDKLRN 126
                         ******************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521726.4E-1516134IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.7E-1516138No hitNo description
PROSITE profilePS5011019.5419132IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.9E-620127IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.49E-721131No hitNo description
PROSITE profilePS5129415.194314373IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-26315373IPR009057Homeodomain-like
SuperFamilySSF466894.84E-18316374IPR009057Homeodomain-like
TIGRFAMsTIGR015577.5E-25317372IPR006447Myb domain, plants
PfamPF002493.4E-7320369IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MVCTRNDLSA WKDFPKGLRV LLLDEDTNSA AEIKSKLEAM DYIVYTFCNE NEALSAVSSR  60
PESFHVAIVE VCTNSNNGGF KFLETAKDLP TIMTSNIHCI STMMKCIALG AVEFLRKPLS  120
EDKLRNIWQH VVHKAFSAGG DDLSESLKPV KDYVASMLHQ QLENGECKHE DLDKIEDASM  180
IHENDHEPSA VNNKYPAPST PQLQQGGRLI VNGDCQEHTN CSMEKESGEP DGESKSVETT  240
SGHTIAEVIA PVGQHQKPRE TMVKEEADSV DGAKGERTLD SHPQDRVNSE DSRAGAEKPN  300
TVSGLHSSRP NKANRKKLKV DWTTELHKKF VQAVDQLGID QAIPSRILEL MKVEGLTRHN  360
VASHLQKYRM HKRHILPKED DRRWPQRDQT QRSCHPHKPI MAFPPYHSNP VPVGPVYPMW  420
GTPHPASIQT WGSQGYYHPW QPTESWQWKP YPGVHADAWG CPVMPIPQGN CSTFTQNGYG  480
FHCSRTMDNR SGMPQNSIQH QPAEEVIDEV VKEAINKPWL PLPLGLKPPS TESVLAELSR  540
QGISTIPPRN QRL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-16315370358ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475747.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
RefseqXP_012475748.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
RefseqXP_012475749.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
RefseqXP_012475750.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
SwissprotQ6LA431e-144APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A0D2R7E10.0A0A0D2R7E1_G
STRINGVIT_02s0012g00570.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-146ARR-B family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]